Drop links or images here to add them to the editor.

#peptide mass

Proteins are not only important building blocks of the muscles in our bodies, but they are also the “workhorses” in our cells, speeding up biochemical reactions, for example. Proteins are chains made up of combinations of 20 amino acids. We refer to it as a protein when an amino acid chain is at least 100 amino acids long; for shorter chains, we speak of peptides. Each protein or peptide has a specific weight, which is usually expressed in the unit Dalton. The weight of a single amino acid can be calculated from its structural formula. When forming an amino acid chain, one H2O molecule (18.0153 Daltons) is released for each covalent bond formed between two amino acids.

PeptideBond

That is why the masses of amino acids are often given as the sum of all atoms, minus 18.0153. The mass of a peptide is the sum of the masses of the amino acids as shown in the mass table, plus the mass of one H2O (18.0153 Daltons).

Mass table:

amino acid mass
A 71.03711
C 103.00919
D 115.02694
E 129.04259
F 147.06841
G 57.02146
H 137.05891
I 113.08406
K 128.09496
L 113.08406
M 131.04049
N 114.04293
P 97.05276
Q 128.05858
R 156.10111
S 87.03203
T 101.04768
V 99.06841
W 186.07931
Y 163.06333

Assignment

Tips

Examples

>>> is_aa_sequence("DIEFRVLHQ")
True
>>> is_aa_sequence("ABCDEFGHILJKLMNOPQRSTUV")
False
>>> peptide_or_protein("DIEFRVLHQ")
True
>>> peptide_or_protein("MEKFLKYEIKVNNEQARANPNYGIFEVGPLESGFVITIGNAMRRVLLSCIPGASVFALSISGAKQEFAAVEGMKEDVTEVVLNFKQLVVKISDLLFEDGEMVEPPLERWPLLTVTAEKAG")
False
>>> frequency_aa("DIEFRVLHQ")
(0, 0, 1, 1, 1, 0, 1, 1, 0, 1, 0, 0, 0, 1, 1, 0, 0, 1, 0, 0)
>>> mass_aa((0, 0, 1, 1, 1, 0, 1, 1, 0, 1, 0, 0, 0, 1, 1, 0, 0, 1, 0, 0))
1155.60837
>>> info_sequence("DIEFRVLHQ")
"This is a peptide of 9 amino acids and a mass of 1155.60837 Dalton"
>>> info_sequence("ABCDEFGHILJKLMNOPQRSTUV")
"That is not an amino acid sequence"