Drop links or images here to add them to the editor.

Proteins are large biomolecules, or macromolecules, consisting of one or more long chains of amino acid residues. The mass (molecular weight) of a protein is thus nothing more the sum of the masses of the amino acids (if we do not take into account modifications etc.). The molecular weight of proteins differ and are very important forinstance when you wish to predict the location of a protein of interest on a gel in relation to a set of protein standards.

Similar to DNA, proteins are often represented as a sequence where every letter is a different amino acid. A stands for alanine, C for cysteine and so on…

Assignment

Write a program to determine the mass in dalton of a protein. You can use the given dictionary with the masses (in Dalton) of the individual amino acids.

aa_mass = {
    'A': 71.03711,   'G': 57.02146,   'M': 131.04049, 'S': 87.03203,
    'C': 103.00919,  'H': 137.05891,  'N': 114.04293, 'T': 101.04768,
    'D': 115.02694,  'I': 113.08406,  'P': 97.05276,  'V': 99.06841,
    'E': 129.04259,  'K': 128.09496,  'Q': 128.05858, 'W': 186.07931,
    'F': 147.06841,  'L': 113.08406,  'R': 156.10111, 'Y': 163.06333
}

Input

The first line contains the name (ID) of a protein. The subsequenct lines the amino acid sequence of a protein (60 characters at a time). The sequence ends with an empty line.

Output

A single line with a string: Protein #### has a mass of ####.## Da.

Example

Input:

CH10
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Output:

Protein CH10 has a mass of 10906.86 Da.