To generalize the Cyclopeptide Sequencing Problem from finding a cyclic peptide with theoretical spectrum matching an ideal spectrum to handle noisy spectra, we need to relax the requirement that a candidate peptide’s theoretical spectrum must match the experimental spectrum exactly, and instead incorporate a scoring function that will select the peptide whose theoretical spectrum matches the given experimental spectrum the most closely.
Given a cyclic peptide Peptide and a spectrum Spectrum, we define score(Peptide, Spectrum) as the number of masses shared between cyclospectrum(Peptide) and Spectrum. E.g. if Spectrum = {0, 99, 113, 114, 128, 227, 257, 299, 355, 356, 370, 371, 484}, then score("NQEL", Spectrum) = 11.
The scoring function should take into account the multiplicities of shared masses, i.e., how many times they occur in each spectrum. For example, suppose that Spectrum is the theoretical spectrum of "NQEL"; for this spectrum, mass 242 has multiplicity 2. If 242 has multiplicity 1 in the theoretical spectrum of Peptide, then 242 contributes 1 to score(Peptide, Spectrum). If 242 has larger multiplicity in the theoretical spectrum of Peptide, then 242 contributes 2 to score(Peptide, Spectrum).
Write a Python function score which computes the score of a cyclic peptide against a spectrum. The function takes as parameters an amino acid string Peptide and a collection of integers Spectrum. It returns the score of Peptide against Spectrum.
>>> score("NQEL", [0, 99, 113, 114, 128, 227, 257, 299, 355, 356, 370, 371, 484])
11
>>> score("VYYEVDWTMGRQIDPDEYPIAQCTRHRATILTLPDWQM",[0, 71, 71, 87, 87, 97, 97, 99, 101, 101, 101, 101, 103, 113, 113, 113, 113, 113, 115, 115, 115, 115, 128, 128, 129, 129, 131, 131, 137, 147, 156, 156, 156, 163, 163, 163, 163, 172, 184, 186, 186, 199, 204, 210, 212, 212, 214, 214, 214, 216, 218, 226, 227, 228, 230, 231, 232, 243, 244, 244, 257, 259, 260, 260, 262, 273, 276, 278, 278, 281, 285, 287, 292, 293, 293, 301, 302, 303, 312, 314, 319, 325, 326, 327, 327, 327, 327, 328, 331, 332, 341, 358, 360, 364, 373, 374, 374, 375, 377, 389, 390, 391, 393, 394, 398, 402, 403, 407, 407, 409, 415, 416, 418, 425, 428, 429, 440, 440, 441, 441, 444, 445, 449, 456, 464, 465, 472, 475, 488, 490, 492, 494, 497, 499, 502, 503, 503, 504, 504, 505, 505, 512, 516, 517, 520, 521, 521, 531, 540, 541, 544, 550, 554, 556, 559, 560, 569, 570, 572, 573, 577, 578, 587, 592, 592, 601, 603, 605, 612, 613, 617, 618, 618, 619, 621, 621, 622, 625, 628, 634, 634, 653, 655, 657, 659, 661, 669, 671, 672, 675, 678, 680, 684, 688, 691, 696, 701, 704, 705, 707, 714, 715, 716, 716, 718, 721, 722, 723, 724, 732, 734, 735, 743, 748, 749, 749, 756, 768, 769, 775, 776, 781, 781, 785, 791, 792, 799, 800, 804, 806, 808, 809, 816, 819, 822, 822, 825, 829, 829, 830, 835, 836, 836, 843, 846, 847, 850, 852, 852, 870, 872, 877, 879, 887, 890, 895, 900, 904, 905, 905, 906, 912, 913, 919, 919, 921, 923, 928, 931, 932, 935, 937, 938, 942, 942, 944, 947, 948, 948, 953, 959, 961, 965, 976, 985, 985, 985, 992, 999, 1005, 1008, 1013, 1015, 1016, 1020, 1024, 1024, 1028, 1032, 1035, 1036, 1036, 1036, 1043, 1046, 1049, 1050, 1051, 1061, 1061, 1062, 1062, 1066, 1068, 1069, 1073, 1075, 1076, 1089, 1090, 1098, 1100, 1114, 1117, 1122, 1123, 1131, 1132, 1133, 1133, 1133, 1137, 1137, 1137, 1139, 1141, 1148, 1149, 1152, 1155, 1160, 1162, 1162, 1163, 1174, 1174, 1176, 1179, 1183, 1191, 1198, 1199, 1201, 1201, 1204, 1219, 1220, 1224, 1225, 1229, 1232, 1232, 1234, 1244, 1245, 1248, 1250, 1250, 1252, 1252, 1253, 1261, 1261, 1262, 1263, 1264, 1265, 1273, 1280, 1288, 1296, 1302, 1302, 1305, 1312, 1313, 1316, 1316, 1318, 1325, 1332, 1335, 1335, 1339, 1345, 1347, 1349, 1350, 1351, 1354, 1354, 1360, 1362, 1363, 1363, 1367, 1369, 1376, 1377, 1387, 1388, 1391, 1392, 1392, 1393, 1397, 1403, 1410, 1415, 1417, 1425, 1425, 1428, 1433, 1434, 1440, 1444, 1451, 1460, 1463, 1464, 1464, 1464, 1464, 1464, 1465, 1469, 1475, 1477, 1479, 1488, 1491, 1492, 1497, 1501, 1502, 1505, 1510, 1520, 1525, 1525, 1526, 1526, 1530, 1531, 1534, 1540, 1540, 1543, 1547, 1548, 1556, 1561, 1564, 1564, 1566, 1577, 1578, 1579, 1588, 1590, 1590, 1592, 1593, 1597, 1603, 1606, 1619, 1623, 1626, 1627, 1627, 1627, 1628, 1634, 1635, 1637, 1637, 1638, 1639, 1641, 1648, 1648, 1653, 1662, 1665, 1671, 1674, 1676, 1677, 1681, 1689, 1693, 1693, 1695, 1703, 1706, 1708, 1719, 1724, 1724, 1727, 1729, 1734, 1735, 1738, 1740, 1742, 1742, 1750, 1752, 1752, 1753, 1754, 1754, 1756, 1760, 1763, 1765, 1766, 1778, 1784, 1785, 1790, 1792, 1794, 1804, 1804, 1806, 1808, 1821, 1821, 1823, 1832, 1837, 1837, 1837, 1851, 1853, 1853, 1853, 1855, 1857, 1857, 1862, 1865, 1866, 1866, 1867, 1871, 1871, 1875, 1879, 1879, 1883, 1885, 1889, 1890, 1891, 1897, 1905, 1908, 1916, 1919, 1923, 1928, 1933, 1936, 1941, 1941, 1949, 1952, 1964, 1966, 1966, 1966, 1966, 1967, 1968, 1968, 1977, 1980, 1984, 1984, 1985, 1988, 1992, 2000, 2004, 2004, 2009, 2010, 2012, 2020, 2020, 2022, 2028, 2031, 2034, 2034, 2036, 2037, 2041, 2046, 2051, 2052, 2053, 2056, 2065, 2079, 2079, 2081, 2081, 2087, 2091, 2093, 2097, 2097, 2105, 2111, 2113, 2115, 2116, 2122, 2123, 2124, 2129, 2131, 2133, 2135, 2138, 2139, 2140, 2147, 2148, 2152, 2153, 2159, 2160, 2165, 2168, 2168, 2169, 2178, 2180, 2184, 2187, 2192, 2197, 2198, 2206, 2206, 2209, 2215, 2224, 2226, 2237, 2237, 2240, 2244, 2244, 2244, 2247, 2250, 2253, 2255, 2260, 2263, 2264, 2266, 2268, 2269, 2277, 2280, 2286, 2287, 2293, 2293, 2294, 2296, 2297, 2300, 2301, 2307, 2309, 2310, 2311, 2315, 2315, 2324, 2334, 2337, 2339, 2341, 2352, 2354, 2356, 2359, 2369, 2378, 2378, 2382, 2383, 2384, 2386, 2392, 2393, 2396, 2397, 2399, 2400, 2400, 2406, 2407, 2413, 2416, 2424, 2425, 2427, 2429, 2430, 2433, 2438, 2440, 2443, 2446, 2449, 2449, 2449, 2453, 2456, 2456, 2467, 2469, 2478, 2484, 2487, 2487, 2495, 2496, 2501, 2506, 2509, 2513, 2515, 2524, 2525, 2525, 2528, 2533, 2534, 2540, 2541, 2545, 2546, 2553, 2554, 2555, 2558, 2560, 2562, 2564, 2569, 2570, 2571, 2577, 2578, 2580, 2582, 2588, 2596, 2596, 2600, 2602, 2606, 2612, 2612, 2614, 2614, 2628, 2637, 2640, 2641, 2642, 2647, 2652, 2656, 2657, 2659, 2659, 2662, 2665, 2671, 2673, 2673, 2681, 2683, 2684, 2689, 2689, 2693, 2701, 2705, 2708, 2709, 2709, 2713, 2716, 2725, 2725, 2726, 2727, 2727, 2727, 2727, 2729, 2741, 2744, 2752, 2752, 2757, 2760, 2765, 2770, 2774, 2777, 2785, 2788, 2796, 2802, 2803, 2804, 2808, 2810, 2814, 2814, 2818, 2822, 2822, 2826, 2827, 2827, 2828, 2831, 2836, 2836, 2838, 2840, 2840, 2840, 2842, 2856, 2856, 2856, 2861, 2870, 2872, 2872, 2885, 2887, 2889, 2889, 2899, 2901, 2903, 2908, 2909, 2915, 2927, 2928, 2930, 2933, 2937, 2939, 2939, 2940, 2941, 2941, 2943, 2951, 2951, 2953, 2955, 2958, 2959, 2964, 2966, 2969, 2969, 2974, 2985, 2987, 2990, 2998, 3000, 3000, 3004, 3012, 3016, 3017, 3019, 3022, 3028, 3031, 3040, 3045, 3045, 3052, 3054, 3055, 3056, 3056, 3058, 3059, 3065, 3066, 3066, 3066, 3067, 3070, 3074, 3087, 3090, 3096, 3100, 3101, 3103, 3103, 3105, 3114, 3115, 3116, 3127, 3129, 3129, 3132, 3137, 3145, 3146, 3150, 3153, 3153, 3159, 3162, 3163, 3167, 3167, 3168, 3168, 3173, 3183, 3188, 3191, 3192, 3196, 3201, 3202, 3205, 3214, 3216, 3218, 3224, 3228, 3229, 3229, 3229, 3229, 3229, 3230, 3233, 3242, 3249, 3253, 3259, 3260, 3265, 3268, 3268, 3276, 3278, 3283, 3290, 3296, 3300, 3301, 3301, 3302, 3305, 3306, 3316, 3317, 3324, 3326, 3330, 3330, 3331, 3333, 3339, 3339, 3342, 3343, 3344, 3346, 3348, 3354, 3358, 3358, 3361, 3368, 3375, 3377, 3377, 3380, 3381, 3388, 3391, 3391, 3397, 3405, 3413, 3420, 3428, 3429, 3430, 3431, 3432, 3432, 3440, 3441, 3441, 3443, 3443, 3445, 3448, 3449, 3459, 3461, 3461, 3464, 3468, 3469, 3473, 3474, 3489, 3492, 3492, 3494, 3495, 3502, 3510, 3514, 3517, 3519, 3519, 3530, 3531, 3531, 3533, 3538, 3541, 3544, 3545, 3552, 3554, 3556, 3556, 3556, 3560, 3560, 3560, 3561, 3562, 3570, 3571, 3576, 3579, 3593, 3595, 3603, 3604, 3617, 3618, 3620, 3624, 3625, 3627, 3631, 3631, 3632, 3632, 3642, 3643, 3644, 3647, 3650, 3657, 3657, 3657, 3658, 3661, 3665, 3669, 3669, 3673, 3677, 3678, 3680, 3685, 3688, 3694, 3701, 3708, 3708, 3708, 3717, 3728, 3732, 3734, 3740, 3745, 3745, 3746, 3749, 3751, 3751, 3755, 3756, 3758, 3761, 3762, 3765, 3770, 3772, 3774, 3774, 3780, 3781, 3787, 3788, 3788, 3789, 3793, 3798, 3803, 3806, 3814, 3816, 3821, 3823, 3841, 3841, 3843, 3846, 3847, 3850, 3857, 3857, 3858, 3863, 3864, 3864, 3868, 3871, 3871, 3874, 3877, 3884, 3885, 3887, 3889, 3893, 3894, 3901, 3902, 3908, 3912, 3912, 3917, 3918, 3924, 3925, 3937, 3944, 3944, 3945, 3950, 3958, 3959, 3961, 3969, 3970, 3971, 3972, 3975, 3977, 3977, 3978, 3979, 3986, 3988, 3989, 3992, 3997, 4002, 4005, 4009, 4013, 4015, 4018, 4021, 4022, 4024, 4032, 4034, 4036, 4038, 4040, 4059, 4059, 4065, 4068, 4071, 4072, 4072, 4074, 4075, 4075, 4076, 4080, 4081, 4088, 4090, 4092, 4101, 4101, 4106, 4115, 4116, 4120, 4121, 4123, 4124, 4133, 4134, 4137, 4139, 4143, 4149, 4152, 4153, 4162, 4172, 4172, 4173, 4176, 4177, 4181, 4188, 4188, 4189, 4189, 4190, 4190, 4191, 4194, 4196, 4199, 4201, 4203, 4205, 4218, 4221, 4228, 4229, 4237, 4244, 4248, 4249, 4252, 4252, 4253, 4253, 4264, 4265, 4268, 4275, 4277, 4278, 4284, 4286, 4286, 4290, 4291, 4295, 4299, 4300, 4302, 4303, 4304, 4316, 4318, 4319, 4319, 4320, 4329, 4333, 4335, 4352, 4361, 4362, 4365, 4366, 4366, 4366, 4366, 4367, 4368, 4374, 4379, 4381, 4390, 4391, 4392, 4400, 4400, 4401, 4406, 4408, 4412, 4415, 4415, 4417, 4420, 4431, 4433, 4433, 4434, 4436, 4449, 4449, 4450, 4461, 4462, 4463, 4465, 4466, 4467, 4475, 4477, 4479, 4479, 4479, 4481, 4481, 4483, 4489, 4494, 4507, 4507, 4509, 4521, 4530, 4530, 4530, 4530, 4537, 4537, 4537, 4546, 4556, 4562, 4562, 4564, 4564, 4565, 4565, 4578, 4578, 4578, 4578, 4580, 4580, 4580, 4580, 4580, 4590, 4592, 4592, 4592, 4592, 4594, 4596, 4596, 4606, 4606, 4622, 4622, 4693])
521